Lineage for d2cita1 (2cit A:9-282)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819166Protein Endoglucanase H N-terminal domain [141783] (1 species)
  7. 1819167Species Clostridium thermocellum [TaxId:1515] [141784] (2 PDB entries)
    Uniprot P16218 29-304! Uniprot P16218 31-304
  8. 1819168Domain d2cita1: 2cit A:9-282 [130499]

Details for d2cita1

PDB Entry: 2cit (more details), 1.4 Å

PDB Description: structure of the covalent intermediate of a family 26 lichenase
PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d2cita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cita1 c.1.8.3 (A:9-282) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]}
lkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilmit
wepweyntvdikngkadayitrmaqdmkaygkeiwlrplhaangdwypwaigyssrvntn
etyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgynwg
ttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirtsyn
kviaavwfhenketdwrinsspealaayreaiga

SCOPe Domain Coordinates for d2cita1:

Click to download the PDB-style file with coordinates for d2cita1.
(The format of our PDB-style files is described here.)

Timeline for d2cita1: