Lineage for d2cika2 (2cik A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021049Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)
  8. 1021059Domain d2cika2: 2cik A:1-181 [130497]
    Other proteins in same PDB: d2cika1, d2cikb_
    automatically matched to d1a1ma2
    complexed with gol

Details for d2cika2

PDB Entry: 2cik (more details), 1.75 Å

PDB Description: insights into crossreactivity in human allorecognition: the structure of hla-b35011 presenting an epitope derived from cytochrome p450.
PDB Compounds: (A:) hla class I histocompatibility antigen b-35 alpha chain

SCOPe Domain Sequences for d2cika2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cika2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2cika2:

Click to download the PDB-style file with coordinates for d2cika2.
(The format of our PDB-style files is described here.)

Timeline for d2cika2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cika1
View in 3D
Domains from other chains:
(mouse over for more information)
d2cikb_