SCOPe 2.07: Domain d2cija1: 2cij A:594-750

Lineage for d2cija1 (2cij A:594-750)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family)
   automatically mapped to Pfam PF04253

5. Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)

6. Protein Glutamate carboxypeptidase II [140574] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries)
   Uniprot Q04609 594-750

8. Domain d2cija1: 2cij A:594-750 [130493]
   Other proteins in same PDB: d2cija2, d2cija3
   automated match to d2c6ca1
   complexed with ca, cl, met, nag, zn

Details for d2cija1

PDB Entry: 2cij, 2.4 Å

PDB Description: membrane-bound glutamate carboxypeptidase ii (gcpii) with bound methionine

PDB Compounds: (A:) glutamate carboxypeptidase II

SCOPe Domain Sequences for d2cija1:

Sequence; same for both SEQRES and ATOM records:

>d2cija1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Timeline for d2cija1:

• d2cija1 first appeared in SCOP 1.73
  
• d2cija1 appears in SCOPe 2.06
  
• d2cija1 appears in the current release, SCOPe 2.08