Lineage for d2ciia2 (2cii A:3-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719630Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (15 PDB entries)
  8. 719643Domain d2ciia2: 2cii A:3-180 [130491]
    Other proteins in same PDB: d2ciia1, d2ciib1
    automatically matched to d1ddha2
    complexed with gol

Details for d2ciia2

PDB Entry: 2cii (more details), 2.55 Å

PDB Description: the crystal structure of h-2db complexed with a partial peptide epitope suggests an mhc class i assembly-intermediate
PDB Compounds: (A:) h-2 class I histocompatibility antigen d-b alpha chain

SCOP Domain Sequences for d2ciia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ciia2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOP Domain Coordinates for d2ciia2:

Click to download the PDB-style file with coordinates for d2ciia2.
(The format of our PDB-style files is described here.)

Timeline for d2ciia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ciia1
View in 3D
Domains from other chains:
(mouse over for more information)
d2ciib1