Lineage for d2ciia1 (2cii A:182-274)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 932954Domain d2ciia1: 2cii A:182-274 [130490]
    Other proteins in same PDB: d2ciia2, d2ciib_
    automatically matched to d1ddha1
    complexed with gol

Details for d2ciia1

PDB Entry: 2cii (more details), 2.55 Å

PDB Description: the crystal structure of h-2db complexed with a partial peptide epitope suggests an mhc class i assembly-intermediate
PDB Compounds: (A:) h-2 class I histocompatibility antigen d-b alpha chain

SCOPe Domain Sequences for d2ciia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ciia1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwalngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d2ciia1:

Click to download the PDB-style file with coordinates for d2ciia1.
(The format of our PDB-style files is described here.)

Timeline for d2ciia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ciia2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ciib_