Lineage for d2ciea_ (2cie A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051631Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1051652Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 1051653Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
  6. 1051673Protein automated matches [190247] (4 species)
    not a true protein
  7. 1051674Species Halobacterium salinarium [TaxId:2242] [187030] (3 PDB entries)
  8. 1051675Domain d2ciea_: 2cie A: [130488]
    automated match to d1moga_
    complexed with cl, fad, mg, na, so4

Details for d2ciea_

PDB Entry: 2cie (more details), 1.8 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands
PDB Compounds: (A:) vng1446h

SCOPe Domain Sequences for d2ciea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ciea_ d.230.2.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
feld

SCOPe Domain Coordinates for d2ciea_:

Click to download the PDB-style file with coordinates for d2ciea_.
(The format of our PDB-style files is described here.)

Timeline for d2ciea_: