![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.2: Dodecin-like [89807] (1 family) ![]() |
![]() | Family d.230.2.1: Dodecin-like [89808] (2 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name |
![]() | Protein Flavin-binding protein dodecin [89809] (1 species) |
![]() | Species Archaeon Halobacterium salinarum [TaxId:2242] [89810] (12 PDB entries) |
![]() | Domain d2ciea1: 2cie A:2-65 [130488] automatically matched to d1moga_ complexed with cl, fad, mg, na, so4 |
PDB Entry: 2cie (more details), 1.8 Å
SCOP Domain Sequences for d2ciea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ciea1 d.230.2.1 (A:2-65) Flavin-binding protein dodecin {Archaeon Halobacterium salinarum [TaxId: 2242]} vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva feld
Timeline for d2ciea1: