Lineage for d2ciea1 (2cie A:2-65)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881009Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 881030Superfamily d.230.2: Dodecin-like [89807] (1 family) (S)
  5. 881031Family d.230.2.1: Dodecin-like [89808] (2 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
  6. 881032Protein Flavin-binding protein dodecin [89809] (1 species)
  7. 881033Species Archaeon Halobacterium salinarum [TaxId:2242] [89810] (12 PDB entries)
  8. 881042Domain d2ciea1: 2cie A:2-65 [130488]
    automatically matched to d1moga_
    complexed with cl, fad, mg, na, so4

Details for d2ciea1

PDB Entry: 2cie (more details), 1.8 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands
PDB Compounds: (A:) vng1446h

SCOP Domain Sequences for d2ciea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ciea1 d.230.2.1 (A:2-65) Flavin-binding protein dodecin {Archaeon Halobacterium salinarum [TaxId: 2242]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
feld

SCOP Domain Coordinates for d2ciea1:

Click to download the PDB-style file with coordinates for d2ciea1.
(The format of our PDB-style files is described here.)

Timeline for d2ciea1: