SCOP 1.73: Domain d2cica1: 2cic A:1-229

Lineage for d2cica1 (2cic A:1-229)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
   one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains

6. Protein Type II deoxyuridine triphosphatase [101388] (2 species)

7. Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries)

8. Domain d2cica1: 2cic A:1-229 [130487]
   automatically matched to d1w2ya_
   complexed with dup, mg

Details for d2cica1

PDB Entry: 2cic, 1.7 Å

PDB Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhpp

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotide hydrolase

SCOP Domain Sequences for d2cica1:

Sequence, based on SEQRES records:

>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka

Sequence, based on observed residues (ATOM records):

>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeydfkaiatevnavsvfqdfckeeeypnegdi
ygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnng
ykdgsykktwngkednevlaqileqeldfdtiykkleecykka

Timeline for d2cica1:

• d2cica1 is new in SCOP 1.73
  
• d2cica1 appears in SCOP 1.75
  
• d2cica1 appears in the current release, SCOPe 2.08, called d2cica_