Class a: All alpha proteins [46456] (258 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein) one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains |
Protein Type II deoxyuridine triphosphatase [101388] (2 species) |
Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries) |
Domain d2cica1: 2cic A:1-229 [130487] automatically matched to d1w2ya_ complexed with dup, mg |
PDB Entry: 2cic (more details), 1.7 Å
SCOP Domain Sequences for d2cica1:
Sequence, based on SEQRES records: (download)
>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]} mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]} mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk nissltnwenvrieivdiwhfilsllleeydfkaiatevnavsvfqdfckeeeypnegdi ygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnng ykdgsykktwngkednevlaqileqeldfdtiykkleecykka
Timeline for d2cica1: