Lineage for d2chub_ (2chu B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143557Family c.92.2.4: TM0189-like [142789] (4 protein domains)
    Part of Pfam PF01497 that include some other superfamily members
  6. 2143572Protein automated matches [190559] (3 species)
    not a true protein
  7. 2143578Species Campylobacter jejuni [TaxId:197] [187546] (4 PDB entries)
  8. 2143579Domain d2chub_: 2chu B: [130486]
    Other proteins in same PDB: d2chua1
    automated match to d2chua1
    complexed with eca, fe, zn

Details for d2chub_

PDB Entry: 2chu (more details), 2.4 Å

PDB Description: ceue in complex with mecam
PDB Compounds: (B:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d2chub_:

Sequence, based on SEQRES records: (download)

>d2chub_ c.92.2.4 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
pismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpky
lqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfls
sfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpqs
rfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgild
nalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

Sequence, based on observed residues (ATOM records): (download)

>d2chub_ c.92.2.4 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
pismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpky
lqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfls
sfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpqs
rfgiihdvlginavdenikvgksinsefileknpdyifvvdrnvilgnkeraqgildnal
vaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

SCOPe Domain Coordinates for d2chub_:

Click to download the PDB-style file with coordinates for d2chub_.
(The format of our PDB-style files is described here.)

Timeline for d2chub_: