SCOPe 2.08: Domain d2chob1: 2cho B:437-590

Lineage for d2chob1 (2cho B:437-590)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
   Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611

8. Domain d2chob1: 2cho B:437-590 [130482]
   Other proteins in same PDB: d2choa2, d2choa3, d2chob2, d2chob3
   automatically matched to 2CHN A:437-590
   complexed with act, ca, gol

Details for d2chob1

PDB Entry: 2cho, 1.85 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity

PDB Compounds: (B:) glucosaminidase

SCOPe Domain Sequences for d2chob1:

Sequence; same for both SEQRES and ATOM records:

>d2chob1 a.246.1.1 (B:437-590) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdy

Timeline for d2chob1:

• d2chob1 first appeared in SCOP 1.73
  
• d2chob1 appears in SCOPe 2.07