![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
![]() | Protein N-acetylglucosamine kinase, NAGK, C-terminal domain [418992] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419464] (2 PDB entries) Uniprot Q9UJ70 |
![]() | Domain d2ch6d1: 2ch6 D:118-344 [130467] Other proteins in same PDB: d2ch6a2, d2ch6b2, d2ch6c2, d2ch6d2 automated match to d2ch5a1 complexed with adp, glc |
PDB Entry: 2ch6 (more details), 2.72 Å
SCOPe Domain Sequences for d2ch6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch6d1 c.55.1.5 (D:118-344) N-acetylglucosamine kinase, NAGK, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dggvvlisgtgsncrlinpdgsesgcggwghmmgdegsaywiahqavkivfdsidnleaa phdigyvkqamfhyfqvpdrlgilthlyrdfdkcrfagfcrkiaegaqqgdplsryifrk agemlgrhivavlpeidpvlfqgkiglpilcvgsvwkswellkegfllaltqgreiqaqn ffssftlmklrhssalggaslgarhighllpmdysanaiafysytfs
Timeline for d2ch6d1: