Lineage for d2ch6d1 (2ch6 D:118-344)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884457Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)
  6. 2884484Protein N-acetylglucosamine kinase, NAGK, C-terminal domain [418992] (1 species)
  7. 2884485Species Human (Homo sapiens) [TaxId:9606] [419464] (2 PDB entries)
    Uniprot Q9UJ70
  8. 2884493Domain d2ch6d1: 2ch6 D:118-344 [130467]
    Other proteins in same PDB: d2ch6a2, d2ch6b2, d2ch6c2, d2ch6d2
    automated match to d2ch5a1
    complexed with adp, glc

Details for d2ch6d1

PDB Entry: 2ch6 (more details), 2.72 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose
PDB Compounds: (D:) n-acetyl-d-glucosamine kinase

SCOPe Domain Sequences for d2ch6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch6d1 c.55.1.5 (D:118-344) N-acetylglucosamine kinase, NAGK, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dggvvlisgtgsncrlinpdgsesgcggwghmmgdegsaywiahqavkivfdsidnleaa
phdigyvkqamfhyfqvpdrlgilthlyrdfdkcrfagfcrkiaegaqqgdplsryifrk
agemlgrhivavlpeidpvlfqgkiglpilcvgsvwkswellkegfllaltqgreiqaqn
ffssftlmklrhssalggaslgarhighllpmdysanaiafysytfs

SCOPe Domain Coordinates for d2ch6d1:

Click to download the PDB-style file with coordinates for d2ch6d1.
(The format of our PDB-style files is described here.)

Timeline for d2ch6d1: