SCOPe 2.08: Domain d2ch6c2: 2ch6 C:2-117

Lineage for d2ch6c2 (2ch6 C:2-117)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)

6. Protein N-acetylglucosamine kinase, NAGK, N-terminal domain [418993] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419465] (2 PDB entries)
   Uniprot Q9UJ70

8. Domain d2ch6c2: 2ch6 C:2-117 [130466]
   Other proteins in same PDB: d2ch6a1, d2ch6b1, d2ch6c1, d2ch6d1
   automated match to d2ch5a2
   complexed with adp, glc
   has additional insertions and/or extensions that are not grouped together

Details for d2ch6c2

PDB Entry: 2ch6, 2.72 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose

PDB Compounds: (C:) n-acetyl-d-glucosamine kinase

SCOPe Domain Sequences for d2ch6c2:

Sequence, based on SEQRES records:

>d2ch6c2 c.55.1.5 (C:2-117) N-acetylglucosamine kinase, NAGK, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrkag
vdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp

Sequence, based on observed residues (ATOM records):

>d2ch6c2 c.55.1.5 (C:2-117) N-acetylglucosamine kinase, NAGK, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aaiyggvegggtrsevllvsedgkilaeadglstngtdkcverinemvnrakrkagvdpl
vplrslglslsggedagrilieelrdrfpylsesylittdaagsiatatp

Timeline for d2ch6c2:

• d2ch6c2 first appeared in SCOP 1.73
  
• d2ch6c2 appears in SCOPe 2.07