SCOPe 2.08: Domain d2ch5d1: 2ch5 D:118-344

Lineage for d2ch5d1 (2ch5 D:118-344)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)

6. Protein N-acetylglucosamine kinase, NAGK, C-terminal domain [418992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419464] (2 PDB entries)
   Uniprot Q9UJ70

8. Domain d2ch5d1: 2ch5 D:118-344 [130459]
   Other proteins in same PDB: d2ch5a2, d2ch5a3, d2ch5b2, d2ch5b3, d2ch5c2, d2ch5c3, d2ch5d2, d2ch5d3
   automated match to d2ch5a1
   complexed with gol, nag, ndg

Details for d2ch5d1

PDB Entry: 2ch5, 1.9 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine

PDB Compounds: (D:) nagk protein

SCOPe Domain Sequences for d2ch5d1:

Sequence, based on SEQRES records:

>d2ch5d1 c.55.1.5 (D:118-344) N-acetylglucosamine kinase, NAGK, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dggvvlisgtgsncrlinpdgsesgcggwghmmgdegsaywiahqavkivfdsidnleaa
phdigyvkqamfhyfqvpdrlgilthlyrdfdkcrfagfcrkiaegaqqgdplsryifrk
agemlgrhivavlpeidpvlfqgkiglpilcvgsvwkswellkegfllaltqgreiqaqn
ffssftlmklrhssalggaslgarhighllpmdysanaiafysytfs

Sequence, based on observed residues (ATOM records):

>d2ch5d1 c.55.1.5 (D:118-344) N-acetylglucosamine kinase, NAGK, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dggvvlisgtgsncrlinpdgsesgcggwghmmgdegsaywiahqavkivfdsidnleaa
phdigyvkqamfhyfqvpdrlgilthlyrdfdkcrfagfcrkiaegaqqgdplsryifrk
agemlgrhivavlpeidpvlfqgkiglpilcvgsvwkswellkegfllaltqgreifssf
tlmklrhssalggaslgarhighllpmdysanaiafysytfs

Timeline for d2ch5d1:

• d2ch5d1 first appeared in SCOP 1.73
  
• d2ch5d1 appears in SCOPe 2.07