SCOP 1.73: Domain d2ch5c2: 2ch5 C:1-117

Lineage for d2ch5c2 (2ch5 C:1-117)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)

6. Protein N-acetylglucosamine kinase, NAGK [142458] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142459] (2 PDB entries)

8. Domain d2ch5c2: 2ch5 C:1-117 [130458]
   automatically matched to 2CH5 A:1-117
   complexed with gol, nag, ndg

Details for d2ch5c2

PDB Entry: 2ch5, 1.9 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine

PDB Compounds: (C:) nagk protein

SCOP Domain Sequences for d2ch5c2:

Sequence; same for both SEQRES and ATOM records:

>d2ch5c2 c.55.1.5 (C:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]}
maaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrka
gvdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp

Timeline for d2ch5c2:

• d2ch5c2 is new in SCOP 1.73
  
• d2ch5c2 appears in SCOP 1.75
  
• d2ch5c2 appears in the current release, SCOPe 2.08