Lineage for d2ch4y1 (2ch4 Y:9-147)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400741Superfamily b.40.7: CheW-like [50341] (2 families) (S)
    automatically mapped to Pfam PF01584
  5. 2400742Family b.40.7.1: CheW-like [50342] (3 proteins)
    duplication: tandem repeat of two swapped domains, one with a canonical OB-fold topology and one with a circular permutation
  6. 2400743Protein Chemotaxis protein CheW [69271] (1 species)
  7. 2400744Species Thermotoga maritima [TaxId:2336] [69272] (2 PDB entries)
  8. 2400746Domain d2ch4y1: 2ch4 Y:9-147 [130452]
    Other proteins in same PDB: d2ch4a1, d2ch4a2, d2ch4a3, d2ch4b1, d2ch4b2, d2ch4b3
    automatically matched to d1k0sa_
    complexed with anp

Details for d2ch4y1

PDB Entry: 2ch4 (more details), 3.5 Å

PDB Description: complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
PDB Compounds: (Y:) chemotaxis protein chew

SCOPe Domain Sequences for d2ch4y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch4y1 b.40.7.1 (Y:9-147) Chemotaxis protein CheW {Thermotoga maritima [TaxId: 2336]}
kefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgriipvvnlaki
lgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgkkskglvkt
dgrliiyldidkiieeitv

SCOPe Domain Coordinates for d2ch4y1:

Click to download the PDB-style file with coordinates for d2ch4y1.
(The format of our PDB-style files is described here.)

Timeline for d2ch4y1: