Lineage for d2ch4b2 (2ch4 B:355-539)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732704Family d.122.1.3: Histidine kinase [55884] (7 proteins)
  6. 732717Protein Histidine kinase CheA [55887] (1 species)
  7. 732718Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)
  8. 732733Domain d2ch4b2: 2ch4 B:355-539 [130450]
    Other proteins in same PDB: d2ch4a1, d2ch4b1, d2ch4w1, d2ch4y1
    automatically matched to d1b3qa3
    complexed with anp

Details for d2ch4b2

PDB Entry: 2ch4 (more details), 3.5 Å

PDB Description: complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
PDB Compounds: (B:) chemotaxis protein chea

SCOP Domain Sequences for d2ch4b2:

Sequence, based on SEQRES records: (download)

>d2ch4b2 d.122.1.3 (B:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkvt
irlpl

Sequence, based on observed residues (ATOM records): (download)

>d2ch4b2 d.122.1.3 (B:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfsmdvvknvveslngsisiesekdkgtkvtirlpl

SCOP Domain Coordinates for d2ch4b2:

Click to download the PDB-style file with coordinates for d2ch4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ch4b2: