![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.7: CheW-like [50341] (2 families) ![]() automatically mapped to Pfam PF01584 |
![]() | Family b.40.7.1: CheW-like [50342] (3 proteins) duplication: tandem repeat of two swapped domains, one with a canonical OB-fold topology and one with a circular permutation |
![]() | Protein Histidine kinase CheA, C-terminal domain [50343] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [50344] (2 PDB entries) |
![]() | Domain d2ch4b1: 2ch4 B:540-671 [130449] Other proteins in same PDB: d2ch4a2, d2ch4a3, d2ch4b2, d2ch4b3, d2ch4w1, d2ch4y1 automatically matched to d1b3qa2 complexed with anp |
PDB Entry: 2ch4 (more details), 3.5 Å
SCOPe Domain Sequences for d2ch4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch4b1 b.40.7.1 (B:540-671) Histidine kinase CheA, C-terminal domain {Thermotoga maritima [TaxId: 2336]} tlaiiqallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipvyrlwevl qiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdg sialiinvsgiv
Timeline for d2ch4b1: