Lineage for d2ch4b1 (2ch4 B:540-671)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791150Superfamily b.40.7: CheW-like [50341] (2 families) (S)
    automatically mapped to Pfam PF01584
  5. 2791151Family b.40.7.1: CheW-like [50342] (3 proteins)
    duplication: tandem repeat of two swapped domains, one with a canonical OB-fold topology and one with a circular permutation
  6. 2791157Protein Histidine kinase CheA, C-terminal domain [50343] (1 species)
  7. 2791158Species Thermotoga maritima [TaxId:2336] [50344] (2 PDB entries)
  8. 2791162Domain d2ch4b1: 2ch4 B:540-671 [130449]
    Other proteins in same PDB: d2ch4a2, d2ch4a3, d2ch4b2, d2ch4b3, d2ch4w1, d2ch4y1
    automatically matched to d1b3qa2
    complexed with anp

Details for d2ch4b1

PDB Entry: 2ch4 (more details), 3.5 Å

PDB Description: complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d2ch4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch4b1 b.40.7.1 (B:540-671) Histidine kinase CheA, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tlaiiqallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipvyrlwevl
qiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdg
sialiinvsgiv

SCOPe Domain Coordinates for d2ch4b1:

Click to download the PDB-style file with coordinates for d2ch4b1.
(The format of our PDB-style files is described here.)

Timeline for d2ch4b1: