SCOP 1.73: Domain d2ch4a2: 2ch4 A:355-539

Lineage for d2ch4a2 (2ch4 A:355-539)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.3: Histidine kinase [55884] (7 proteins)

6. Protein Histidine kinase CheA [55887] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)

8. Domain d2ch4a2: 2ch4 A:355-539 [130448]
   Other proteins in same PDB: d2ch4a1, d2ch4b1, d2ch4w1, d2ch4y1
   automatically matched to d1b3qa3
   complexed with anp

Details for d2ch4a2

PDB Entry: 2ch4, 3.5 Å

PDB Description: complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew

PDB Compounds: (A:) chemotaxis protein chea

SCOP Domain Sequences for d2ch4a2:

Sequence; same for both SEQRES and ATOM records:

>d2ch4a2 d.122.1.3 (A:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkvt
irlpl

Timeline for d2ch4a2:

• d2ch4a2 is new in SCOP 1.73
  
• d2ch4a2 appears in SCOP 1.75
  
• d2ch4a2 appears in the current release, SCOPe 2.08