![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
![]() | Protein Histidine kinase CheA [55887] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries) |
![]() | Domain d2ch4a2: 2ch4 A:355-539 [130448] Other proteins in same PDB: d2ch4a1, d2ch4a3, d2ch4b1, d2ch4b3, d2ch4w1, d2ch4y1 automatically matched to d1b3qa3 complexed with anp |
PDB Entry: 2ch4 (more details), 3.5 Å
SCOPe Domain Sequences for d2ch4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch4a2 d.122.1.3 (A:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkvt irlpl
Timeline for d2ch4a2: