Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (66 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [187029] (2 PDB entries) |
Domain d2ch2b_: 2ch2 B: [130444] automated match to d1h0ca_ complexed with ky1, plp |
PDB Entry: 2ch2 (more details), 2.7 Å
SCOPe Domain Sequences for d2ch2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch2b_ c.67.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge cstvqkiqfylygfkeslkathpdyif
Timeline for d2ch2b_: