Lineage for d2ch2b1 (2ch2 B:3-389)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840802Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 840811Protein 3-hydroxykynurenine transaminase [142667] (1 species)
  7. 840812Species Malaria mosquito (Anopheles gambiae) [TaxId:7165] [142668] (2 PDB entries)
    Uniprot Q4LAM2 2-389
  8. 840818Domain d2ch2b1: 2ch2 B:3-389 [130444]
    automatically matched to 2CH1 A:2-389
    complexed with ky1

Details for d2ch2b1

PDB Entry: 2ch2 (more details), 2.7 Å

PDB Description: Structure of the Anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor
PDB Compounds: (B:) 3-hydroxykynurenine transaminase

SCOP Domain Sequences for d2ch2b1:

Sequence, based on SEQRES records: (download)

>d2ch2b1 c.67.1.3 (B:3-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll
lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
cstvqkiqfylygfkeslkathpdyif

Sequence, based on observed residues (ATOM records): (download)

>d2ch2b1 c.67.1.3 (B:3-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
slcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdllll
gnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmgl
difvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimgec
stvqkiqfylygfkeslkathpdyif

SCOP Domain Coordinates for d2ch2b1:

Click to download the PDB-style file with coordinates for d2ch2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ch2b1: