Lineage for d2ch1b_ (2ch1 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614353Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [187029] (2 PDB entries)
  8. 1614354Domain d2ch1b_: 2ch1 B: [130440]
    Other proteins in same PDB: d2ch1a1
    automated match to d1h0ca_
    complexed with gol, plp

Details for d2ch1b_

PDB Entry: 2ch1 (more details), 2.4 Å

PDB Description: Structure of Anopheles gambiae 3-hydroxykynurenine transaminase
PDB Compounds: (B:) 3-hydroxykynurenine transaminase

SCOPe Domain Sequences for d2ch1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch1b_ c.67.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
aslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdll
llgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkm
gldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimg
ecstvqkiqfylygfkeslkathpdyif

SCOPe Domain Coordinates for d2ch1b_:

Click to download the PDB-style file with coordinates for d2ch1b_.
(The format of our PDB-style files is described here.)

Timeline for d2ch1b_: