Lineage for d2ch1a1 (2ch1 A:2-389)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705666Family c.67.1.3: Cystathionine synthase-like [53402] (16 protein domains)
  6. 705675Protein 3-hydroxykynurenine transaminase [142667] (1 species)
  7. 705676Species Malaria mosquito (Anopheles gambiae) [TaxId:7165] [142668] (2 PDB entries)
  8. 705677Domain d2ch1a1: 2ch1 A:2-389 [130439]
    complexed with gol

Details for d2ch1a1

PDB Entry: 2ch1 (more details), 2.4 Å

PDB Description: Structure of Anopheles gambiae 3-hydroxykynurenine transaminase
PDB Compounds: (A:) 3-hydroxykynurenine transaminase

SCOP Domain Sequences for d2ch1a1:

Sequence, based on SEQRES records: (download)

>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
aslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdll
llgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkm
gldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimg
ecstvqkiqfylygfkeslkathpdyif

Sequence, based on observed residues (ATOM records): (download)

>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
aslcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdlll
lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
cstvqkiqfylygfkeslkathpdyif

SCOP Domain Coordinates for d2ch1a1:

Click to download the PDB-style file with coordinates for d2ch1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ch1a1: