Lineage for d2ch1a1 (2ch1 A:2-389)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131448Protein 3-hydroxykynurenine transaminase [142667] (1 species)
  7. 2131449Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [142668] (1 PDB entry)
    Uniprot Q4LAM2 2-389
  8. 2131450Domain d2ch1a1: 2ch1 A:2-389 [130439]
    Other proteins in same PDB: d2ch1b_, d2ch1c_, d2ch1d_
    complexed with gol, plp

Details for d2ch1a1

PDB Entry: 2ch1 (more details), 2.4 Å

PDB Description: Structure of Anopheles gambiae 3-hydroxykynurenine transaminase
PDB Compounds: (A:) 3-hydroxykynurenine transaminase

SCOPe Domain Sequences for d2ch1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
aslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdll
llgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkm
gldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimg
ecstvqkiqfylygfkeslkathpdyif

SCOPe Domain Coordinates for d2ch1a1:

Click to download the PDB-style file with coordinates for d2ch1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ch1a1: