Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cell cycle checkpoint kinase chk1 [64404] (1 species) CaMK group; CAMKL subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [64405] (27 PDB entries) |
Domain d2cgxa1: 2cgx A:6-273 [130438] automatically matched to d1ia8a_ complexed with 3d3 |
PDB Entry: 2cgx (more details), 2.2 Å
SCOP Domain Sequences for d2cgxa1:
Sequence, based on SEQRES records: (download)
>d2cgxa1 d.144.1.7 (A:6-273) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} vedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkmlnhe nvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgig ithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefh aepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhki lvenpsaritipdikkdrwynkplkkga
>d2cgxa1 d.144.1.7 (A:6-273) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} vedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnhenvv kfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigith rdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaep vdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilve npsaritipdikkdrwynkplkkga
Timeline for d2cgxa1: