Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries) |
Domain d2cgua_: 2cgu A: [130435] automated match to d3nlba_ complexed with 3a3 |
PDB Entry: 2cgu (more details), 2.5 Å
SCOPe Domain Sequences for d2cgua_:
Sequence, based on SEQRES records: (download)
>d2cgua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkmlnhe nvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgig ithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefh aepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhki lvenpsaritipdikkdrwynkplkk
>d2cgua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnhenvv kfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigith rdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaep vdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilve npsaritipdikkdrwynkplkk
Timeline for d2cgua_: