Lineage for d2cgtu1 (2cgt U:5-111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1311670Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1311671Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1311672Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 1311776Protein GP31 co-chaperonin [50134] (1 species)
  7. 1311777Species Bacteriophage T4 [TaxId:10665] [50135] (2 PDB entries)
  8. 1311791Domain d2cgtu1: 2cgt U:5-111 [130434]
    automatically matched to d1g31a_

Details for d2cgtu1

PDB Entry: 2cgt (more details), 8.2 Å

PDB Description: groel-adp-gp31 complex
PDB Compounds: (U:) capsid assembly protein gp31

SCOPe Domain Sequences for d2cgtu1:

Sequence, based on SEQRES records: (download)

>d2cgtu1 b.35.1.1 (U:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpegfce
vgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk

Sequence, based on observed residues (ATOM records): (download)

>d2cgtu1 b.35.1.1 (U:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
kqpkeikqkfvtchykaipclyk

SCOPe Domain Coordinates for d2cgtu1:

Click to download the PDB-style file with coordinates for d2cgtu1.
(The format of our PDB-style files is described here.)

Timeline for d2cgtu1: