Lineage for d2cgtt1 (2cgt T:5-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785354Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2785469Protein GP31 co-chaperonin [50134] (1 species)
  7. 2785470Species Bacteriophage T4 [TaxId:10665] [50135] (2 PDB entries)
  8. 2785483Domain d2cgtt1: 2cgt T:5-111 [130433]
    automatically matched to d1g31a_

Details for d2cgtt1

PDB Entry: 2cgt (more details), 8.2 Å

PDB Description: groel-adp-gp31 complex
PDB Compounds: (T:) capsid assembly protein gp31

SCOPe Domain Sequences for d2cgtt1:

Sequence, based on SEQRES records: (download)

>d2cgtt1 b.35.1.1 (T:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpegfce
vgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk

Sequence, based on observed residues (ATOM records): (download)

>d2cgtt1 b.35.1.1 (T:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
kqpkeikqkfvtchykaipclyk

SCOPe Domain Coordinates for d2cgtt1:

Click to download the PDB-style file with coordinates for d2cgtt1.
(The format of our PDB-style files is described here.)

Timeline for d2cgtt1: