Lineage for d2cgtq1 (2cgt Q:5-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666135Family b.35.1.1: GroES [50130] (2 proteins)
  6. 666239Protein GP31 co-chaperonin [50134] (1 species)
  7. 666240Species Bacteriophage T4 [TaxId:10665] [50135] (2 PDB entries)
  8. 666250Domain d2cgtq1: 2cgt Q:5-111 [130430]
    automatically matched to d1g31a_

Details for d2cgtq1

PDB Entry: 2cgt (more details)

PDB Description: groel-adp-gp31 complex
PDB Compounds: (Q:) capsid assembly protein gp31

SCOP Domain Sequences for d2cgtq1:

Sequence, based on SEQRES records: (download)

>d2cgtq1 b.35.1.1 (Q:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpegfce
vgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk

Sequence, based on observed residues (ATOM records): (download)

>d2cgtq1 b.35.1.1 (Q:5-111) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
kqpkeikqkfvtchykaipclyk

SCOP Domain Coordinates for d2cgtq1:

Click to download the PDB-style file with coordinates for d2cgtq1.
(The format of our PDB-style files is described here.)

Timeline for d2cgtq1: