Lineage for d2cgna1 (2cgn A:13-349)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810188Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 810307Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 810308Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 810309Species Human (Homo sapiens) [TaxId:9606] [82196] (10 PDB entries)
  8. 810316Domain d2cgna1: 2cgn A:13-349 [130426]
    automatically matched to d1mzea_
    complexed with fe, sin, so4

Details for d2cgna1

PDB Entry: 2cgn (more details), 2.4 Å

PDB Description: factor inhibiting hif-1 alpha with succinate
PDB Compounds: (A:) hypoxia-inducible factor 1 alpha inhibitor

SCOP Domain Sequences for d2cgna1:

Sequence, based on SEQRES records: (download)

>d2cgna1 b.82.2.6 (A:13-349) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvyp
alkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvekl
qdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligme
gnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerf
pnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplka
hqkvaimrniekmlgealgnpqevgpllntmikgryn

Sequence, based on observed residues (ATOM records): (download)

>d2cgna1 b.82.2.6 (A:13-349) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvyp
alkwdleylqenigngdfsvysasthkflyydekkmanfnreemkfhefveklqdiqqre
erlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegnvtpahyd
eqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpnfqnvvgy
etvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahqkvaimrn
iekmlgealgnpqevgpllntmikgryn

SCOP Domain Coordinates for d2cgna1:

Click to download the PDB-style file with coordinates for d2cgna1.
(The format of our PDB-style files is described here.)

Timeline for d2cgna1: