SCOP 1.73: Domain d2cg6a2: 2cg6 A:62-108

Lineage for d2cg6a2 (2cg6 A:62-108)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (2 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (9 PDB entries)

8. Domain d2cg6a2: 2cg6 A:62-108 [130422]
   automatically matched to d1o9aa2
   complexed with so4

Details for d2cg6a2

PDB Entry: 2cg6, 1.55 Å

PDB Description: second and third fibronectin type i module pair (crystal form i).

PDB Compounds: (A:) human fibronectin

SCOP Domain Sequences for d2cg6a2:

Sequence; same for both SEQRES and ATOM records:

>d2cg6a2 g.27.1.1 (A:62-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

Timeline for d2cg6a2:

• d2cg6a2 is new in SCOP 1.73
  
• d2cg6a2 appears in SCOP 1.75
  
• d2cg6a2 appears in the current release, SCOPe 2.08