SCOPe 2.07: Domain d2cg4b2: 2cg4 B:67-152

Lineage for d2cg4b2 (2cg4 B:67-152)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
   octamer: tetramer of dimers
   automatically mapped to Pfam PF01037

6. Protein Regulatory protein AsnC [143261] (1 species)

7. Species Escherichia coli [TaxId:562] [143262] (1 PDB entry)
   Uniprot P0ACI6 67-152

8. Domain d2cg4b2: 2cg4 B:67-152 [130420]
   Other proteins in same PDB: d2cg4a1, d2cg4b1
   automated match to d2cg4a2
   complexed with asn, mg

Details for d2cg4b2

PDB Entry: 2cg4, 2.4 Å

PDB Description: structure of e.coli asnc

PDB Compounds: (B:) regulatory protein asnc

SCOPe Domain Sequences for d2cg4b2:

Sequence; same for both SEQRES and ATOM records:

>d2cg4b2 d.58.4.2 (B:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}
dvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvlink
iqtideiqstetlivlqnpimrtikp

Timeline for d2cg4b2:

• d2cg4b2 first appeared in SCOP 1.73
  
• d2cg4b2 appears in SCOPe 2.06
  
• d2cg4b2 appears in the current release, SCOPe 2.08