SCOPe 2.07: Domain d2cg4b1: 2cg4 B:4-66

Lineage for d2cg4b1 (2cg4 B:4-66)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
   Swapped dimer with the "wing" C-terminal strands
   automatically mapped to Pfam PF13412

6. Protein Regulatory protein AsnC [140235] (1 species)

7. Species Escherichia coli [TaxId:562] [140236] (1 PDB entry)
   Uniprot P0ACI6 4-66

8. Domain d2cg4b1: 2cg4 B:4-66 [130419]
   Other proteins in same PDB: d2cg4a2, d2cg4b2
   automated match to d2cg4a1
   complexed with asn, mg

Details for d2cg4b1

PDB Entry: 2cg4, 2.4 Å

PDB Description: structure of e.coli asnc

PDB Compounds: (B:) regulatory protein asnc

SCOPe Domain Sequences for d2cg4b1:

Sequence; same for both SEQRES and ATOM records:

>d2cg4b1 a.4.5.32 (B:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}
ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq
lgy

Timeline for d2cg4b1:

• d2cg4b1 first appeared in SCOP 1.73
  
• d2cg4b1 appears in SCOPe 2.06
  
• d2cg4b1 appears in the current release, SCOPe 2.08