Lineage for d2cg4b1 (2cg4 B:4-66)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635579Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
    Swapped dimer with the "wing" C-terminal strands
  6. 635588Protein Regulatory protein AsnC [140235] (1 species)
  7. 635589Species Escherichia coli [TaxId:562] [140236] (1 PDB entry)
  8. 635591Domain d2cg4b1: 2cg4 B:4-66 [130419]
    Other proteins in same PDB: d2cg4a2, d2cg4b2
    automatically matched to 2CG4 A:4-66
    complexed with asn, mg; mutant

Details for d2cg4b1

PDB Entry: 2cg4 (more details), 2.4 Å

PDB Description: structure of e.coli asnc
PDB Compounds: (B:) regulatory protein asnc

SCOP Domain Sequences for d2cg4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cg4b1 a.4.5.32 (B:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}
ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq
lgy

SCOP Domain Coordinates for d2cg4b1:

Click to download the PDB-style file with coordinates for d2cg4b1.
(The format of our PDB-style files is described here.)

Timeline for d2cg4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cg4b2