![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries) Uniprot P46881 9-628 |
![]() | Domain d2cg0a3: 2cg0 A:97-211 [130413] Other proteins in same PDB: d2cg0a1 automated match to d1rjoa3 complexed with cu, gol, na, r9a, so4 |
PDB Entry: 2cg0 (more details), 1.8 Å
SCOPe Domain Sequences for d2cg0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cg0a3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
Timeline for d2cg0a3: