SCOPe 2.04: Domain d2cfxh2: 2cfx H:64-140

Lineage for d2cfxh2 (2cfx H:64-140)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
   octamer: tetramer of dimers
   automatically mapped to Pfam PF01037

6. Protein Transcriptional regulator LrpC [143259] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143260] (1 PDB entry)
   Uniprot P96582 64-140

8. Domain d2cfxh2: 2cfx H:64-140 [130410]
   Other proteins in same PDB: d2cfxa1, d2cfxb1, d2cfxc1, d2cfxd1, d2cfxe1, d2cfxf1, d2cfxg1, d2cfxh1
   automated match to d2cfxa2

Details for d2cfxh2

PDB Entry: 2cfx, 2.4 Å

PDB Description: structure of b.subtilis lrpc

PDB Compounds: (H:) hth-type transcriptional regulator lrpc

SCOPe Domain Sequences for d2cfxh2:

Sequence; same for both SEQRES and ATOM records:

>d2cfxh2 d.58.4.2 (H:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
pvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfinkts
pyaqtvthvifseidtk

Timeline for d2cfxh2:

• d2cfxh2 first appeared in SCOP 1.73
  
• d2cfxh2 appears in SCOPe 2.03
  
• d2cfxh2 appears in SCOPe 2.05
  
• d2cfxh2 appears in the current release, SCOPe 2.08