Lineage for d2cfxg1 (2cfx G:1-63)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307340Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
    Swapped dimer with the "wing" C-terminal strands
    automatically mapped to Pfam PF13412
  6. 2307369Protein Transcriptional regulator LrpC [140237] (1 species)
  7. 2307370Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry)
    Uniprot P96582 1-63
  8. 2307377Domain d2cfxg1: 2cfx G:1-63 [130407]
    Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2
    automated match to d2cfxa1

Details for d2cfxg1

PDB Entry: 2cfx (more details), 2.4 Å

PDB Description: structure of b.subtilis lrpc
PDB Compounds: (G:) hth-type transcriptional regulator lrpc

SCOPe Domain Sequences for d2cfxg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfxg1 a.4.5.32 (G:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
lgl

SCOPe Domain Coordinates for d2cfxg1:

Click to download the PDB-style file with coordinates for d2cfxg1.
(The format of our PDB-style files is described here.)

Timeline for d2cfxg1: