Lineage for d2cfxf2 (2cfx F:64-140)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723761Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (4 proteins)
    octamer: tetramer of dimers
  6. 723774Protein Transcriptional regulator LrpC [143259] (1 species)
  7. 723775Species Bacillus subtilis [TaxId:1423] [143260] (1 PDB entry)
  8. 723781Domain d2cfxf2: 2cfx F:64-140 [130406]
    Other proteins in same PDB: d2cfxa1, d2cfxb1, d2cfxc1, d2cfxd1, d2cfxe1, d2cfxf1, d2cfxg1, d2cfxh1
    automatically matched to 2CFX A:64-140

Details for d2cfxf2

PDB Entry: 2cfx (more details), 2.4 Å

PDB Description: structure of b.subtilis lrpc
PDB Compounds: (F:) hth-type transcriptional regulator lrpc

SCOP Domain Sequences for d2cfxf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfxf2 d.58.4.2 (F:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
pvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfinkts
pyaqtvthvifseidtk

SCOP Domain Coordinates for d2cfxf2:

Click to download the PDB-style file with coordinates for d2cfxf2.
(The format of our PDB-style files is described here.)

Timeline for d2cfxf2: