SCOPe 2.06: Domain d2cfxf1: 2cfx F:1-63

Lineage for d2cfxf1 (2cfx F:1-63)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
   Swapped dimer with the "wing" C-terminal strands
   automatically mapped to Pfam PF13412

6. Protein Transcriptional regulator LrpC [140237] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry)
   Uniprot P96582 1-63

8. Domain d2cfxf1: 2cfx F:1-63 [130405]
   Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2
   automated match to d2cfxa1

Details for d2cfxf1

PDB Entry: 2cfx, 2.4 Å

PDB Description: structure of b.subtilis lrpc

PDB Compounds: (F:) hth-type transcriptional regulator lrpc

SCOPe Domain Sequences for d2cfxf1:

Sequence; same for both SEQRES and ATOM records:

>d2cfxf1 a.4.5.32 (F:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
lgl

Timeline for d2cfxf1:

• d2cfxf1 first appeared in SCOP 1.73
  
• d2cfxf1 appears in SCOPe 2.05
  
• d2cfxf1 appears in SCOPe 2.07
  
• d2cfxf1 appears in the current release, SCOPe 2.08