| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins) Swapped dimer with the "wing" C-terminal strands |
| Protein Transcriptional regulator LrpC [140237] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry) |
| Domain d2cfxe1: 2cfx E:1-63 [130403] Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2 automatically matched to 2CFX A:1-63 |
PDB Entry: 2cfx (more details), 2.4 Å
SCOP Domain Sequences for d2cfxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfxe1 a.4.5.32 (E:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
lgl
Timeline for d2cfxe1: