Lineage for d2cfwa3 (2cfw A:97-211)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855404Species Arthrobacter globiformis [TaxId:1665] [54421] (39 PDB entries)
    Uniprot P46881 9-628
  8. 855432Domain d2cfwa3: 2cfw A:97-211 [130394]
    Other proteins in same PDB: d2cfwa1
    automatically matched to d1av4_3
    complexed with cu, gol, na, r7u, so4

Details for d2cfwa3

PDB Entry: 2cfw (more details), 1.74 Å

PDB Description: agao in complex with wc7a (ru-wire inhibitor, 7-carbon linker, data set a)
PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d2cfwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfwa3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d2cfwa3:

Click to download the PDB-style file with coordinates for d2cfwa3.
(The format of our PDB-style files is described here.)

Timeline for d2cfwa3: