Lineage for d2cfwa2 (2cfw A:9-96)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895888Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1895889Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1895890Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1895891Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1895916Domain d2cfwa2: 2cfw A:9-96 [130393]
    Other proteins in same PDB: d2cfwa1
    automated match to d1rjoa2
    complexed with cu, gol, na, r7u, so4

Details for d2cfwa2

PDB Entry: 2cfw (more details), 1.74 Å

PDB Description: agao in complex with wc7a (ru-wire inhibitor, 7-carbon linker, data set a)
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cfwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfwa2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d2cfwa2:

Click to download the PDB-style file with coordinates for d2cfwa2.
(The format of our PDB-style files is described here.)

Timeline for d2cfwa2: