SCOPe 2.08: Domain d2cfqa_: 2cfq A:

Lineage for d2cfqa_ (2cfq A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
   12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar

4. Superfamily f.38.1: MFS general substrate transporter [103473] (5 families)

5. Family f.38.1.2: LacY-like proton/sugar symporter [103477] (2 proteins)
   automatically mapped to Pfam PF07690
   automatically mapped to Pfam PF01306

6. Protein automated matches [190249] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187028] (2 PDB entries)

8. Domain d2cfqa_: 2cfq A: [130391]
   automated match to d1pv6a_
   complexed with hg

Details for d2cfqa_

PDB Entry: 2cfq, 2.95 Å

PDB Description: sugar free lactose permease at neutral ph

PDB Compounds: (A:) lactose permease

SCOPe Domain Sequences for d2cfqa_:

Sequence; same for both SEQRES and ATOM records:

>d2cfqa_ f.38.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
myylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtgiifaaislfsllfq
plfgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfna
gapaveafiekvsrrsnfefgrarmfgcvgwalgasivgimftinnqfvfwlgsgcalil
avllffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfd
qqfanfftsffatgeqgtrvfgyvttmgellnasimffapliinriggknalllagtims
vriigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkql
amifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsllrrqvneva

Timeline for d2cfqa_:

• d2cfqa_ first appeared in SCOP 1.73, called d2cfqa1
  
• d2cfqa_ appears in SCOPe 2.07