Lineage for d2cfla3 (2cfl A:97-211)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1019765Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1019766Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1019767Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1019768Species Arthrobacter globiformis [TaxId:1665] [54421] (39 PDB entries)
    Uniprot P46881 9-628
  8. 1019798Domain d2cfla3: 2cfl A:97-211 [130389]
    Other proteins in same PDB: d2cfla1
    automatically matched to d1av4_3
    complexed with cu, gol, na, r6a, so4

Details for d2cfla3

PDB Entry: 2cfl (more details), 1.8 Å

PDB Description: agao in complex with wc6b (ru-wire inhibitor, 6-carbon linker, data set b)
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cfla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfla3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d2cfla3:

Click to download the PDB-style file with coordinates for d2cfla3.
(The format of our PDB-style files is described here.)

Timeline for d2cfla3: