Lineage for d2cfka2 (2cfk A:9-96)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181140Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2181141Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2181142Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2181143Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 2181170Domain d2cfka2: 2cfk A:9-96 [130385]
    Other proteins in same PDB: d2cfka1
    automated match to d1rjoa2
    complexed with cu, gol, na, r5a, r5b, so4

Details for d2cfka2

PDB Entry: 2cfk (more details), 1.8 Å

PDB Description: agao in complex with wc5 (ru-wire inhibitor, 5-carbon linker)
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfka2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d2cfka2:

Click to download the PDB-style file with coordinates for d2cfka2.
(The format of our PDB-style files is described here.)

Timeline for d2cfka2: