SCOPe 2.08: Domain d2cfgb2: 2cfg B:9-96

Lineage for d2cfgb2 (2cfg B:9-96)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries)
   Uniprot P46881 9-628

8. Domain d2cfgb2: 2cfg B:9-96 [130380]
   Other proteins in same PDB: d2cfga1, d2cfgb1
   automated match to d1rjoa2
   complexed with cu, gol, na, r4a, so4

Details for d2cfgb2

PDB Entry: 2cfg, 1.55 Å

PDB Description: agao in complex with wc4d3 (ru-wire inhibitor, 4-carbon linker, delta enantiomer, data set 3)

PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cfgb2:

Sequence; same for both SEQRES and ATOM records:

>d2cfgb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d2cfgb2:

• d2cfgb2 first appeared in SCOP 1.73
  
• d2cfgb2 appears in SCOPe 2.07