Lineage for d2cfea1 (2cfe A:1-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674655Protein Cyclophilin-like allergen Mal s 6 [141501] (1 species)
  7. 674656Species Malassezia sympodialis [TaxId:76777] [141502] (1 PDB entry)
  8. 674657Domain d2cfea1: 2cfe A:1-162 [130375]
    complexed with ala, gol, pro

Details for d2cfea1

PDB Entry: 2cfe (more details), 1.5 Å

PDB Description: the 1.5 a crystal structure of the malassezia sympodialis mala s 6 allergen, a member of the cyclophilin pan-allergen family
PDB Compounds: (A:) allergen

SCOP Domain Sequences for d2cfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]}
msnvffditkngaplgtikfklfddvvpktaanfralctgekgfgyagshfhrvipdfml
qggdftagngtggksiygakfadenfqlkhnkpgllsmanagpntngsqffittvvtswl
dgkhvvfgevidgmnvvkaieaegsgsgkprsrieiakcgvc

SCOP Domain Coordinates for d2cfea1:

Click to download the PDB-style file with coordinates for d2cfea1.
(The format of our PDB-style files is described here.)

Timeline for d2cfea1: