Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Cyclophilin-like allergen Mal s 6 [141501] (1 species) |
Species Malassezia sympodialis [TaxId:76777] [141502] (1 PDB entry) Uniprot O93970 1-162 |
Domain d2cfea1: 2cfe A:1-162 [130375] complexed with ala, gol, pro |
PDB Entry: 2cfe (more details), 1.5 Å
SCOPe Domain Sequences for d2cfea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} msnvffditkngaplgtikfklfddvvpktaanfralctgekgfgyagshfhrvipdfml qggdftagngtggksiygakfadenfqlkhnkpgllsmanagpntngsqffittvvtswl dgkhvvfgevidgmnvvkaieaegsgsgkprsrieiakcgvc
Timeline for d2cfea1: