| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries) Uniprot P46881 9-628 |
| Domain d2cfdb3: 2cfd B:97-211 [130374] Other proteins in same PDB: d2cfda1, d2cfdb1 automated match to d1rjoa3 complexed with cu, gol, na, r4a, so4 |
PDB Entry: 2cfd (more details), 1.6 Å
SCOPe Domain Sequences for d2cfdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfdb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
Timeline for d2cfdb3: