SCOP 1.73: Domain d2cfda2: 2cfd A:9-96

Lineage for d2cfda2 (2cfd A:9-96)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (34 PDB entries)

8. Domain d2cfda2: 2cfd A:9-96 [130370]
   Other proteins in same PDB: d2cfda1, d2cfdb1
   automatically matched to d1av4_2
   complexed with cu, gol, na, r4a, so4

Details for d2cfda2

PDB Entry: 2cfd, 1.6 Å

PDB Description: agao in complex with wc4l3 (ru-wire inhibitor, 4-carbon linker, lambda enantiomer, data set 3)

PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d2cfda2:

Sequence; same for both SEQRES and ATOM records:

>d2cfda2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d2cfda2:

• d2cfda2 is new in SCOP 1.73
  
• d2cfda2 appears in SCOP 1.75
  
• d2cfda2 appears in the current release, SCOPe 2.08